SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021443 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021443
Domain Number 1 Region: 125-212
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000103
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000021443
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00366
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021443   Gene: ENSCJAG00000033922   Transcript: ENSCJAT00000022665
Sequence length 393
Comment pep:novel chromosome:C_jacchus3.2.1:14:14719291:14720802:1 gene:ENSCJAG00000033922 transcript:ENSCJAT00000022665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYLGMNDVEMTGSSVFDYIHPGDHSEVLELLGLWALTPGPPTPLLADTPEIEASLTKVPP
SSMVQEHSFFVHMKSTLTKRGLHVKASGYKVIHVTGPLWAHALGLVALGHTLPAAPLAEL
PLHRHMIVFRLHLGLTILACESRVSDHMDLGPSELVGRSCYQFAHGQVATRICQSHVDLL
DKGQVMTGYYRWLQRTGGFVWLQSVATVAGSGKSPREHHVLWVSLVLSQAEGGQTPLDAF
QLPASMTCEDSSSPGREPTEPETPAEEKEAPQMQGKRIKVEPVPRETKGSEDSGDEDPSG
HPAPPRPKFTSLIRAGALKQDPVRPWGLAPPMEPPALLHAGFLPCPACDIRYGPVELGLV
YPHLQRLGPGPALPEAFYSPQGLQAPGRHRRGT
Download sequence
Identical sequences F6RMF0
ENSCJAP00000021443 ENSCJAP00000021443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]