SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021473 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021473
Domain Number 1 Region: 94-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.64e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021473   Gene: ENSCJAG00000011693   Transcript: ENSCJAT00000022698
Sequence length 181
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:72368920:72374358:-1 gene:ENSCJAG00000011693 transcript:ENSCJAT00000022698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDNRSNSSLPDKLPIFSNSACLPMSRSFYLEPTVTFHLHPEAPVPSPYSEELPLLPFPS
DSLIMGNYGEPCPFSFPMPYPNYRRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKCSSMIATTSRHADSMFRI
V
Download sequence
Identical sequences F6R0L6
ENSCJAP00000021473 ENSCJAP00000021473 XP_002755062.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]