SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021567 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021567
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-128
Family ALDH-like 0.0000000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021567   Gene: ENSCJAG00000011685   Transcript: ENSCJAT00000022798
Sequence length 508
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:77054079:77087882:1 gene:ENSCJAG00000011685 transcript:ENSCJAT00000022798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHEVQRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIGSDLCKSEFNAYSQE
VIAVLGEIDFMLENLPEWITAKPVKKNLLTMLDEAYLQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTATILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
ILYTGNTTVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVQKIKETVKEFYGENVKESPDYERIINHRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPVLPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFMLNSFPFGGVGSSGMGAYHGKHTFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVYWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KKYQAVLRRKALLIFLIVHRLRWSSKQR
Download sequence
Identical sequences F6TG74
ENSCJAP00000021567 XP_008995004.1.60252 ENSCJAP00000021567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]