SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021630 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021630
Domain Number 1 Region: 300-356
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000000000222
Family VPS37 C-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 44-105
Classification Level Classification E-value
Superfamily UBC-like 0.000000612
Family UBC-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021630   Gene: ENSCJAG00000011769   Transcript: ENSCJAT00000022865
Sequence length 372
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:21048553:21100588:-1 gene:ENSCJAG00000011769 transcript:ENSCJAT00000022865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSRLLPPQFPQEKPVISVYPP
IRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYLYSNPS
GMPPYASQGFPFLSPYSPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLP
VPAMDASVPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQI
ITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESC
SASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSCFMEKRTICHCRRAKEEKLQQ
AIAMHSQFHAPL
Download sequence
Identical sequences F6RW56
ENSCJAP00000021630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]