SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021640 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021640
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000000000245
Family VPS37 C-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000157
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021640   Gene: ENSCJAG00000011769   Transcript: ENSCJAT00000022875
Sequence length 397
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:21048553:21100588:-1 gene:ENSCJAG00000011769 transcript:ENSCJAT00000022875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNPSGMPPYASQGFPFLSPYSPQEANRSITSLSVADTVS
SSTTSHTTAKPAAPSFGVLSNLPLPVPAMDASVPTSQNGFGYKMPDVPDAFPELSELSVS
QLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK
YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEID
DFLSCFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
Download sequence
Identical sequences F6RK85
ENSCJAP00000021630 ENSCJAP00000021640 XP_003734631.1.60252 XP_008977480.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]