SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021779 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021779
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000155
Family LEM domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021779   Gene: ENSCJAG00000011853   Transcript: ENSCJAT00000023020
Sequence length 255
Comment pep:novel chromosome:C_jacchus3.2.1:X:140802655:140805055:1 gene:ENSCJAG00000011853 transcript:ENSCJAT00000023020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYAGLSDTELAAVLRQYNIPHGPVVGSTRKLYEKKIFEYETQRRRLSPPSSSAASFSY
RFSDLNSPSVDSDMYDLPKKEDALLYQSKGYNDDYYEESYLTTRTYGEPDSAGQSRGFRQ
SATSLPDADTFHHQVRDDNLLSSEEECKDRERPMYGRDSAYQSIAHYRPVSASRSSLGLS
YYPTSSSTSSVSSSSSSPSWLTRRAIRPEKHAPGAGLGHDRQVPLWGQLLLFLVFAIFLF
FVYYFMQAEEGNPFW
Download sequence
Identical sequences F6T3F1
ENSCJAP00000021779 ENSCJAP00000021779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]