SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022019 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022019
Domain Number 1 Region: 24-64
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 6.15e-17
Family A DNA-binding domain in eukaryotic transcription factors 0.00043
Further Details:      
 
Domain Number 2 Region: 52-108
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000297
Family Leucine zipper domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022019   Gene: ENSCJAG00000011992   Transcript: ENSCJAT00000023276
Sequence length 164
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:200653770:200668997:1 gene:ENSCJAG00000011992 transcript:ENSCJAT00000023276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARS
VAAARGTATLVAPASVITIVKSNPGSGSAPFHSPRQALRPQVLP
Download sequence
Identical sequences F7BVR2
ENSCJAP00000022019 ENSCJAP00000045301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]