SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022041 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022041
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 4.71e-29
Family BTB/POZ domain 0.000000707
Further Details:      
 
Domain Number 2 Region: 555-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 499-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-16
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 4 Region: 419-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000048
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022041   Gene: ENSCJAG00000011978   Transcript: ENSCJAT00000023301
Sequence length 673
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:11594272:11797842:1 gene:ENSCJAG00000011978 transcript:ENSCJAT00000023301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQLPPAAEAGQAPASRPEHPAPPAEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
Download sequence
Identical sequences F7BCK8
ENSCJAP00000022038 ENSCJAP00000022041 ENSCJAP00000022038 XP_002754471.1.60252 XP_017833037.1.60252 XP_017833038.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]