SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022056 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022056
Domain Number 1 Region: 14-386
Classification Level Classification E-value
Superfamily ALDH-like 4.79e-135
Family ALDH-like 0.00000000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022056   Gene: ENSCJAG00000001331   Transcript: ENSCJAT00000023318
Sequence length 390
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:96110308:96170383:1 gene:ENSCJAG00000001331 transcript:ENSCJAT00000023318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDVPDLPALLTDLKIQYTKIFINNEWHNSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLMERDRLLLATMESMNGGNTVIVKPA
EQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKIAFTGSTEVGKIIK
EAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGLFYHQGQCCIAASRLFVEESI
YDEFVRRSVERAKKYVLGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPW
GNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTK
DIDKAITISSALQAGTVWVNCYGVGRVRFT
Download sequence
Identical sequences F7AU01
ENSCJAP00000022056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]