SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022057 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022057
Domain Number 1 Region: 30-512
Classification Level Classification E-value
Superfamily ALDH-like 9.56e-164
Family ALDH-like 0.0000000000000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022057   Gene: ENSCJAG00000011989   Transcript: ENSCJAT00000023320
Sequence length 517
Comment pep:novel chromosome:C_jacchus3.2.1:9:101943522:101987029:1 gene:ENSCJAG00000011989 transcript:ENSCJAT00000023320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAARLGPRLGHRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSGKTFPTVNPS
TGEIICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTETGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVDRSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINSGKQEGAKLLCGGGVAADRGYFIQPTVFGDVQDGMTIAKEEVWNP
VVTIPEFGALDSVSPGSGHVMYRMLKELKTKQTNKAIGLTQTEKAIVLKVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences F7ATY6
ENSCJAP00000022057 ENSCJAP00000022057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]