SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022101 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022101
Domain Number 1 Region: 93-145
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 2 Region: 242-295
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000131
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0009
Further Details:      
 
Domain Number 3 Region: 15-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022101   Gene: ENSCJAG00000012019   Transcript: ENSCJAT00000023366
Sequence length 362
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:38242048:38257246:1 gene:ENSCJAG00000012019 transcript:ENSCJAT00000023366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLQRARSATELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCASGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKAEAPPTERCFSLRMKSTLTSRGRTL
NLKAATWKVLHCSGHMRAYKPPAQTSPAGSPSSEPPLQCLVLICEAIPHPGSLEPPLGRG
AFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDFDAVSKSIHTCMYPISP
GLEPAATWPIADTRTLLPSPQNALPPHPNTSSLLPKPQGPVSFLALIPSPRSFSPQLHSW
WP
Download sequence
Identical sequences F6YTJ5
ENSCJAP00000022101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]