SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022124 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022124
Domain Number 1 Region: 41-249
Classification Level Classification E-value
Superfamily LmbE-like 1.03e-53
Family LmbE-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022124   Gene: ENSCJAG00000012025   Transcript: ENSCJAT00000023389
Sequence length 252
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:77856953:77966243:-1 gene:ENSCJAG00000012025 transcript:ENSCJAT00000023389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REAMWLLCLSAVILAWGFLWVWDSSERMKSREQGGLLGAESRTLLVIAHPDDEAMFFAPT
VLGLARLRHRVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPPSSIMIIDHRDFPDDPGV
QWNTEHVASVLLHHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALYLEGKLPKGCSVL
TLQSVNMLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKRAMSCHRSQLLWFRRLYIFF
SRYMRINSLSFL
Download sequence
Identical sequences F6YBD3
ENSCJAP00000022124 ENSCJAP00000022124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]