SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022305 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022305
Domain Number 1 Region: 565-708
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-45
Family Eukaryotic proteases 0.000000656
Further Details:      
 
Domain Number 2 Region: 367-467
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-39
Family Kringle modules 0.00000831
Further Details:      
 
Domain Number 3 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-36
Family Kringle modules 0.0000159
Further Details:      
 
Domain Number 4 Region: 273-358
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-36
Family Kringle modules 0.0000102
Further Details:      
 
Domain Number 5 Region: 464-562
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-34
Family Kringle modules 0.00000859
Further Details:      
 
Domain Number 6 Region: 183-267
Classification Level Classification E-value
Superfamily Kringle-like 2.92e-34
Family Kringle modules 0.00000652
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.37e-20
Family Hairpin loop containing domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022305   Gene: ENSCJAG00000012132   Transcript: ENSCJAT00000023582
Sequence length 709
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:161589507:161632102:1 gene:ENSCJAG00000012132 transcript:ENSCJAT00000023582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHKEVILLLLLFLKSGQGEPLEDYVNTQGASLFSFTKKKLEAGSVKECAAKCEEEREFT
CRSFQYHSKEQQCVIMAENSKSSTIIRLRDVVLFEKKMYLSECKTGNGRNYRGTTSKTKN
GVTCQKWSSTFPHKPKYSPDTHPSEGLEENYCRNPDNDEKGPWCYTTDSEQRYDYCDIPE
CEDECMHCSGENYDGKISKTMSGLECQAWDSQTPHAHGYIPSKFPSKNLKKNYCRNPDGE
PRPWCFTTNPNKRWELCDIPRCTTPPPLSGPTYQCLKGTGENYRGNVAVTVSGHTCQRWS
AQTPHKHNKTPENFPCKNLDENYCRNPDGEKAPWCYTTNSQERWEYCNIPSCESSPVSTE
QLDASAPPELTPVVQDCYHGDGQNYRGTSSTTVTGKKCQSWSSMTPHRHQKTPENYPNAN
LTMNYCRNPDADKSPWCFTTDPTVRWEYCNLKKCSDTEGSVVAPPSVAQVPNVETPSEPE
CILGNGKGYRGKKATTVTGTPCQEWAAQEPHKHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLFDYCDIPQCVSASFDCGKPQVEPKKCPGRIVGGCVAHPHSWPWQVSLRT
RFGTHFCGGTLISPEWVLTAAHCLERSSRPSSYKVILGAHREVNLESHVQEIEVSKMFSG
PKPADIALLKLSSPAIITDKVIPACLPSPNYVVADRTECFITGWGDTKG
Download sequence
Identical sequences F7AA32
ENSCJAP00000022305 ENSCJAP00000022305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]