SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022368 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022368
Domain Number 1 Region: 1726-1893
Classification Level Classification E-value
Superfamily Fibronectin type III 5.86e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 2 Region: 1361-1532
Classification Level Classification E-value
Superfamily Fibronectin type III 6.79e-26
Family Fibronectin type III 0.0000101
Further Details:      
 
Domain Number 3 Region: 1544-1716
Classification Level Classification E-value
Superfamily Fibronectin type III 9.38e-25
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 910-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-24
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 727-895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 1176-1349
Classification Level Classification E-value
Superfamily Fibronectin type III 1.5e-21
Family Fibronectin type III 0.00000779
Further Details:      
 
Domain Number 7 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 2.43e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 9 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000785
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 10 Region: 2160-2203
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 11 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 12 Region: 620-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000584
Family Fibronectin type III 0.00000348
Further Details:      
 
Domain Number 13 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000667
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 14 Region: 468-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000236
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 16 Region: 2115-2158
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000471
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 17 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000576
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000222
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 19 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000327
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 2203-2244
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 21 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000116
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 22 Region: 2029-2093
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000302
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 23 Region: 1094-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000268
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022368   Gene: ENSCJAG00000011714   Transcript: ENSCJAT00000023649
Sequence length 2297
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:131700480:131778183:-1 gene:ENSCJAG00000011714 transcript:ENSCJAT00000023649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLRLLLAALCLGTAVPFTGASRSQRQAQQIVQPPSPVAVSQSKPGCYDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRAS
YRIGDTWSKKDNRGILLQCICTGNGRGEWKCERHTSLQTTSRGSGPFTDLHAAIYQPQPH
PQPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQRYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDEWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHC
QPLQTYASSSGPVQVVITETPSQPNSHPIQWNAPQPSHISQYILRWKPKNSVGRWKEATI
PGHLNSYTIKGLKPGVIYEGQLISIQQYGHQEVTRFDFTTTSTSSPVTSNTVTGETTPFS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDRVDDTSIVVRWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETT
GTPRPDTVPSPRDLQFVEVTDVKVTIMWTPPQSVVTGYRVDVIPVNLPGEHGQRLPISRN
TFAEITGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVIWTR
PRARITGYRLTVGPTRGGQPKQYNVGPSASKYPLRNLQPGSEYTVSLVAVKGNQQSPKVT
GVFSTLQPGNSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIV
VSGLTPGVEYVYTIQVLRDGKERDAPIVNKVVTPLSPPTNLHLESNPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEEVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPI
SDTIIPAVPPPTDLRFTNIGPDTIRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPS
DNAVVLTNLLPGTEYLVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWI
APRATITGYRIRHNPEHQSGRPREDRVPPTRNSITLTNLTPGTEYVVSIIALYGREESPP
LVGQQSTVSDVPRDLEVVAASPTSLLISWDAPAVTVRYYRITYGETGGNSPIQEFTVPGT
KSTATISGLKPGVDYTITLYAVTGRGDSPASSKPVTINYRTEIDKPSQMQVTDVQDNSIS
VKWLPSSSPVTGYRVTTTPKNGPGPTKTKTTGPDQTEMTIEGLQPTVEYVVSVYAQNPNG
ESQPLVQTAVTTIPPPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTINPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLHFLATTPNSLLISWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHVPRGDVDFHLYPYGLGLNPNASTGQEALSQTTISWTPFQES
SEYIISCHPMGNDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLGQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPGTEGSTGHSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
Download sequence
Identical sequences F6Y9W4
ENSCJAP00000022368 XP_008997695.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]