SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022377 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022377
Domain Number 1 Region: 148-279
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-39
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 2 Region: 42-155
Classification Level Classification E-value
Superfamily FKBP-like 1.92e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 257-376
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-37
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 4 Region: 380-487
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-31
Family FKBP immunophilin/proline isomerase 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000022377
Domain Number - Region: 497-534
Classification Level Classification E-value
Superfamily EF-hand 0.00117
Family Calbindin D9K 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022377   Gene: ENSCJAG00000012179   Transcript: ENSCJAT00000023659
Sequence length 542
Comment pep:known_by_projection scaffold:C_jacchus3.2.1:GL286451.1:329550:339590:-1 gene:ENSCJAG00000012179 transcript:ENSCJAT00000023659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAGPPSYSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSILLRPPHCPRMVQDGDFVRYH
YNGTLLDGTSFDTSYSRGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYGTVIPPQASLVFHALLIDVHNPKDTVQLETLELPPGCVRRAVAGDFMRYHYNGSLMDG
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACIGERRRITIPPHLAYGENGTGDKIPG
SAVLIFNVHVIDFHNPADVVEIKTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGENGARGVPGSAVLRFEV
ELVSREDGLPTGYLFVWHEDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRHAWA
GP
Download sequence
Identical sequences H9KWW7
ENSCJAP00000022377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]