SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022384 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022384
Domain Number 1 Region: 3-41
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000235
Family LEM domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022384   Gene: ENSCJAG00000012200   Transcript: ENSCJAT00000023666
Sequence length 477
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:34596998:34613651:-1 gene:ENSCJAG00000012200 transcript:ENSCJAT00000023666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEAGPRGEE
RPREEARLREDGPLRAEPWLSQPTSGSSVRDSVESRSLAYPARPAQLRRRASVQSSSEED
EDARTPDRAVQGPSLVARRYPASARLPSALLSPDPRPSLRATRASLAGAARARPEVGRRL
ERWLSRLLLWASLGLLLVFLGILWVKMGKPSAPQEAEDNMKLLPVDCERKTDEFCQAKQK
AALLELLHELYNFLAIQAGNFECGNPEKLKSKCIPVTEAQEYIANVTSSSSAKFEAALTW
ILSSNKDVGIWLKGEDQSELVTTVDKVVCLESARPRMGVGCRLSRALLTALTNVLIFFWC
LAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIIDVVQDHYVDWEQDMERYPYVGILHVRD
TLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSER
Download sequence
Identical sequences F6XLM6
ENSCJAP00000022384 ENSCJAP00000046976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]