SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022411 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022411
Domain Number 1 Region: 1810-1977
Classification Level Classification E-value
Superfamily Fibronectin type III 5.86e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 2 Region: 1445-1616
Classification Level Classification E-value
Superfamily Fibronectin type III 7.03e-26
Family Fibronectin type III 0.0000101
Further Details:      
 
Domain Number 3 Region: 1629-1800
Classification Level Classification E-value
Superfamily Fibronectin type III 8.6e-25
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 994-1161
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-24
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 811-979
Classification Level Classification E-value
Superfamily Fibronectin type III 5.36e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 1260-1433
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-21
Family Fibronectin type III 0.00000779
Further Details:      
 
Domain Number 7 Region: 493-548
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 433-488
Classification Level Classification E-value
Superfamily Kringle-like 2.48e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 9 Region: 642-688
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000811
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 10 Region: 2213-2256
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 11 Region: 600-644
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 12 Region: 704-785
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000006
Family Fibronectin type III 0.00000348
Further Details:      
 
Domain Number 13 Region: 315-359
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000693
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 14 Region: 552-593
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 178-223
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000249
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 16 Region: 2168-2211
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000488
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 17 Region: 269-312
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000602
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 134-175
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000236
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 19 Region: 226-266
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 2256-2297
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 21 Region: 2070-2146
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000911
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 22 Region: 391-429
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000119
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 23 Region: 1178-1265
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000285
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022411   Gene: ENSCJAG00000011714   Transcript: ENSCJAT00000023697
Sequence length 2350
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:131700893:131778187:-1 gene:ENSCJAG00000011714 transcript:ENSCJAT00000023697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPRRLCCTGGGEGTPGASGERGPAATTSLVLSSRPLPHPLAPPSWRGHPSGGIGRDFSR
RFRRDPVLVATRLRVRAFFPHRLNMLRGPGPGLRLLLAALCLGTAVPFTGASRSQRQAQQ
IVQPPSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEE
TCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWR
RPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTC
LGEGSGRITCTSRNRCNDQDTRASYRIGDTWSKKDNRGILLQCICTGNGRGEWKCERHTS
LQTTSRGSGPFTDLHAAIYQPQPHPQPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCTC
LGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQD
QRYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDAD
QKFGFCPMAAHEEICTTNEGVMYRIGDEWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLR
DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDS
WEKYVHGVRYQCYCYGRGIGEWHCQPLQTYASSSGPVQVVITETPSQPNSHPIQWNAPQP
SHISQYILRWKPKNSVGRWKEATIPGHLNSYTIKGLKPGVIYEGQLISIQQYGHQEVTRF
DFTTTSTSSPVTSNTVTGETTPFSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYE
LSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPP
DPTVDRVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQ
YNITIYAVEENQESTPVVIQQETTGTPRPDTVPSPRDLQFVEVTDVKVTIMWTPPQSVVT
GYRVDVIPVNLPGEHGQRLPISRNTFAEITGLSPGVTYYFKVFAVNHGRESKPLTAQQTT
KLDAPTNLQFVNETDSTVLVIWTRPRARITGYRLTVGPTRGGQPKQYNVGPSASKYPLRN
LQPGSEYTVSLVAVKGNQQSPKVTGVFSTLQPGNSIPPYNTEVTETTIVITWTPAPRIGF
KLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGKERDAPIVNKVVTPLS
PPTNLHLESNPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGYSLEEEVHADQSSCTFD
NLSPGLEYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRFTNIGPDTIRVTWAPPPSIDL
TNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESTPLRGRQK
TGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHNPEHQSGRPREDRVPPTRNSITL
TNLTPGTEYVVSIIALYGREESPPLVGQQSTVSDVPRDLEVVAASPTSLLISWDAPAVTV
RYYRITYGETGGNSPIQEFTVPGTKSTATISGLKPGVDYTITLYAVTGRGDSPASSKPVT
INYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTTGPDQT
EMTIEGLQPTVEYVVSVYAQNPNGESQPLVQTAVTTIPPPTDLKFTQVTPTSLSAQWTPP
NVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQ
GVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTINPDV
RSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLHFLATTPNSLLISWQP
PRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPL
IGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITHPGYDTGNGIQLPGTSGQQPS
VGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGQEALSQTTISWTPFQESSEYIISC
HPMGNDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNE
GLGQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGV
NYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAI
CSCTCFGGQRGWRCDNCRRPGGEPGTEGSTGHSYNQYSQRYHQRTNTNVNCPIECFMPLD
VQADREDSRE
Download sequence
Identical sequences F7HWS5
ENSCJAP00000022411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]