SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022427 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022427
Domain Number 1 Region: 1290-1464
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-28
Family Fibronectin type III 0.000052
Further Details:      
 
Domain Number 2 Region: 1656-1823
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-26
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 653-820
Classification Level Classification E-value
Superfamily Fibronectin type III 2.14e-24
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 4 Region: 1011-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-23
Family Fibronectin type III 0.00000779
Further Details:      
 
Domain Number 5 Region: 470-638
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 152-207
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 1475-1646
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-20
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 8 Region: 92-147
Classification Level Classification E-value
Superfamily Kringle-like 2.28e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 9 Region: 1198-1287
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-20
Family Fibronectin type III 0.00000508
Further Details:      
 
Domain Number 10 Region: 831-1004
Classification Level Classification E-value
Superfamily Fibronectin type III 6.38e-18
Family Fibronectin type III 0.00000722
Further Details:      
 
Domain Number 11 Region: 301-347
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000746
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2059-2102
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000157
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 259-303
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000275
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 363-444
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000552
Family Fibronectin type III 0.00000348
Further Details:      
 
Domain Number 15 Region: 211-252
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 16 Region: 2014-2057
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000454
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 17 Region: 2102-2143
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000131
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 18 Region: 1916-1992
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000841
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 19 Region: 50-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000011
Family Fibronectin type I module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022427   Gene: ENSCJAG00000011714   Transcript: ENSCJAT00000023716
Sequence length 2196
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:131700480:131778171:-1 gene:ENSCJAG00000011714 transcript:ENSCJAT00000023716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAAPGEEREPQARAGRGDLQPQLLWSSPVMLEIKPAIYQPQPHPQPAPYGHCVTDSGVIY
SVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTT
EGRQDGHLWCSTTSNYEQDQRYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTS
EGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDEWDKQHDMGHMMRC
TCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCD
PVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYASSSGPVQVVI
TETPSQPNSHPIQWNAPQPSHISQYILRWKPKNSVGRWKEATIPGHLNSYTIKGLKPGVI
YEGQLISIQQYGHQEVTRFDFTTTSTSSPVTSNTVTGETTPFSPVVATSESVTEITASSF
VVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISED
GEQSLILSTSQTTAPDAPPDPTVDRVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTEL
NLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRPDTVPSPRDLQFV
EVTDVKVTIMWTPPQSVVTGYRVDVIPVNLPGEHGQRLPISRNTFAEITGLSPGVTYYFK
VFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVIWTRPRARITGYRLTVGPTRG
GQPKQYNVGPSASKYPLRNLQPGSEYTVSLVAVKGNQQSPKVTGVFSTLQPGNSIPPYNT
EVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVL
RDGKERDAPIVNKVVTPLSPPTNLHLESNPDTGVLTVSWERSTTPAPDITGYRITTTPTN
GQQGYSLEEEVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLS
FVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDY
DISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTIRVTWAPPPSIDLTNFLVRYS
PVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESTPLRGRQKTGGKTGLD
SPTGIDFSDITANSFTVHWIAPRATITGYRIRHNPEHQSGRPREDRVPPTRNSITLTNLT
PGTEYVVSIIALYGREESPPLVGQQSTVSDVPRDLEVVAASPTSLLISWDAPAVTVRYYR
ITYGETGGNSPIQEFTVPGTKSTATISGLKPGVDYTITLYAVTGRGDSPASSKPVTINYR
TEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTTGPDQTEMTI
EGLQPTVEYVVSVYAQNPNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQV
SRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQS
TAIPPPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVV
SGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTE
TITGFQVDAVPANGQTPIQRTINPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDA
STAIDAPSNLHFLATTPNSLLISWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEAT
ITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQK
TPFITHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPN
VGQEALSQTTISWTPFQESSEYIISCHPMGNDEEPLQFRVPGTSTSATLTGLTRGATYNI
IVEALKDQQRHKVREEVVTVGNSVNEGLGQPTDDSCFDPYTVSHYAVGDEWERMSESGFK
LLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDP
HEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPGTEGSTGHSY
NQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences F7HU65
ENSCJAP00000022427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]