SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022428 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022428
Domain Number 1 Region: 393-448
Classification Level Classification E-value
Superfamily Kringle-like 1.86e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 2 Region: 542-588
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000017
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 3 Region: 500-544
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000641
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 4 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000144
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 5 Region: 452-493
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000366
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 6 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000523
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 7 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000127
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 8 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000497
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 9 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000707
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 10 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000249
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 11 Region: 349-388
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000685
Family Fibronectin type II module 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000022428
Domain Number - Region: 604-634
Classification Level Classification E-value
Superfamily Fibronectin type III 0.022
Family Fibronectin type III 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022428   Gene: ENSCJAG00000011714   Transcript: ENSCJAT00000023717
Sequence length 642
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:131757061:131777989:-1 gene:ENSCJAG00000011714 transcript:ENSCJAT00000023717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLRLLLAALCLGTAVPFTGASRSQRQAQQIVQPPSPVAVSQSKPGCYDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRAS
YRIGDTWSKKDNRGILLQCICTGNGRGEWKCERHTSLQTTSRGSGPFTDLHAAIYQPQPH
PQPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGRCSTTSNYEQDQRYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCT
SEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDEWDKQHDMGHMMR
CTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKC
DPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYASSSGPVQVV
ITETPSQPNSHPIQWNAPQPSHISQYILRWKPVSIPSRNLGY
Download sequence
Identical sequences F7HU63
ENSCJAP00000022428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]