SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022440 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022440
Domain Number 1 Region: 1541-1716
Classification Level Classification E-value
Superfamily Fibronectin type III 2.09e-28
Family Fibronectin type III 0.000052
Further Details:      
 
Domain Number 2 Region: 1907-2074
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-26
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 910-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 2.14e-24
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 4 Region: 1266-1440
Classification Level Classification E-value
Superfamily Fibronectin type III 2.02e-23
Family Fibronectin type III 0.00000779
Further Details:      
 
Domain Number 5 Region: 727-895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 1726-1897
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-20
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 8 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 2.57e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 9 Region: 1449-1538
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-20
Family Fibronectin type III 0.00000508
Further Details:      
 
Domain Number 10 Region: 1174-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 5.87e-17
Family Fibronectin type III 0.00000301
Further Details:      
 
Domain Number 11 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000837
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2285-2328
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 620-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000633
Family Fibronectin type III 0.00000348
Further Details:      
 
Domain Number 15 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000072
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 16 Region: 468-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000183
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000249
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 2240-2283
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000506
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000615
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2328-2369
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 2142-2218
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000952
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 24 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000123
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 25 Region: 1094-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000285
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022440   Gene: ENSCJAG00000011714   Transcript: ENSCJAT00000023729
Sequence length 2422
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:131700480:131778183:-1 gene:ENSCJAG00000011714 transcript:ENSCJAT00000023729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLRLLLAALCLGTAVPFTGASRSQRQAQQIVQPPSPVAVSQSKPGCYDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRAS
YRIGDTWSKKDNRGILLQCICTGNGRGEWKCERHTSLQTTSRGSGPFTDLHAAIYQPQPH
PQPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQRYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDEWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHC
QPLQTYASSSGPVQVVITETPSQPNSHPIQWNAPQPSHISQYILRWKPKNSVGRWKEATI
PGHLNSYTIKGLKPGVIYEGQLISIQQYGHQEVTRFDFTTTSTSSPVTSNTVTGETTPFS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDRVDDTSIVVRWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETT
GTPRPDTVPSPRDLQFVEVTDVKVTIMWTPPQSVVTGYRVDVIPVNLPGEHGQRLPISRN
TFAEITGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVIWTR
PRARITGYRLTVGPTRGGQPKQYNVGPSASKYPLRNLQPGSEYTVSLVAVKGNQQSPKVT
GVFSTLQPGNSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIV
VSGLTPGVEYVYTIQVLRDGKERDAPIVNKVVTPLSPPTNLHLESNPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEEVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPI
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTIRVTWA
PPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHEST
PLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHNPEHQSGRPREDRVPP
TRNSITLTNLTPGTEYVVSIIALYGREESPPLVGQQSTVSDVPRDLEVVAASPTSLLISW
DAPAVTVRYYRITYGETGGNSPIQEFTVPGTKSTATISGLKPGVDYTITLYAVTGRGDSP
ASSKPVTINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTK
TTGPDQTEMTIEGLQPTVEYVVSVYAQNPNGESQPLVQTAVTNIDRPKGLAFTDVDVDSI
KIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDD
MESQPLIGTQSTAIPPPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEI
NLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATET
TITISWRTKTETITGFQVDAVPANGQTPIQRTINPDVRSYTITGLQPGTDYKIYLYTLND
NARSSPVVIDASTAIDAPSNLHFLATTPNSLLISWQPPRARITGYIIKYEKPGSPPREVV
PRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTVQKTPFITHPGYDTGNG
IQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGQEALSQTTISWT
PFQESSEYIISCHPMGNDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVR
EEVVTVGNSVNEGLGQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFR
CDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHV
GEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPGTEGSTGHSYNQYSQRYHQRTNTN
VNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences F7HNH0
XP_008997684.1.60252 ENSCJAP00000022440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]