SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022457 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022457
Domain Number 1 Region: 1541-1715
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-28
Family Fibronectin type III 0.000052
Further Details:      
 
Domain Number 2 Region: 1907-2074
Classification Level Classification E-value
Superfamily Fibronectin type III 6.34e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 910-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 2.14e-24
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 4 Region: 1266-1440
Classification Level Classification E-value
Superfamily Fibronectin type III 2.26e-23
Family Fibronectin type III 0.00000779
Further Details:      
 
Domain Number 5 Region: 727-895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.55e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 1726-1897
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-20
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 8 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 2.63e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 9 Region: 1449-1538
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-20
Family Fibronectin type III 0.00000508
Further Details:      
 
Domain Number 10 Region: 1174-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 6.02e-17
Family Fibronectin type III 0.00000301
Further Details:      
 
Domain Number 11 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000864
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2341-2384
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000327
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 620-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000656
Family Fibronectin type III 0.00000348
Further Details:      
 
Domain Number 15 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000733
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 16 Region: 468-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000183
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 2296-2339
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000523
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2384-2425
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000127
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 24 Region: 2210-2274
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000317
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 25 Region: 1094-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000302
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022457   Gene: ENSCJAG00000011714   Transcript: ENSCJAT00000023748
Sequence length 2478
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:131700480:131778183:-1 gene:ENSCJAG00000011714 transcript:ENSCJAT00000023748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLRLLLAALCLGTAVPFTGASRSQRQAQQIVQPPSPVAVSQSKPGCYDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRAS
YRIGDTWSKKDNRGILLQCICTGNGRGEWKCERHTSLQTTSRGSGPFTDLHAAIYQPQPH
PQPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQRYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDEWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHC
QPLQTYASSSGPVQVVITETPSQPNSHPIQWNAPQPSHISQYILRWKPKNSVGRWKEATI
PGHLNSYTIKGLKPGVIYEGQLISIQQYGHQEVTRFDFTTTSTSSPVTSNTVTGETTPFS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDRVDDTSIVVRWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETT
GTPRPDTVPSPRDLQFVEVTDVKVTIMWTPPQSVVTGYRVDVIPVNLPGEHGQRLPISRN
TFAEITGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVIWTR
PRARITGYRLTVGPTRGGQPKQYNVGPSASKYPLRNLQPGSEYTVSLVAVKGNQQSPKVT
GVFSTLQPGNSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIV
VSGLTPGVEYVYTIQVLRDGKERDAPIVNKVVTPLSPPTNLHLESNPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEEVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPI
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTIRVTWA
PPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHEST
PLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHNPEHQSGRPREDRVPP
TRNSITLTNLTPGTEYVVSIIALYGREESPPLVGQQSTVSDVPRDLEVVAASPTSLLISW
DAPAVTVRYYRITYGETGGNSPIQEFTVPGTKSTATISGLKPGVDYTITLYAVTGRGDSP
ASSKPVTINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTK
TTGPDQTEMTIEGLQPTVEYVVSVYAQNPNGESQPLVQTAVTNIDRPKGLAFTDVDVDSI
KIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDD
MESQPLIGTQSTAIPPPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEI
NLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATET
TITISWRTKTETITGFQVDAVPANGQTPIQRTINPDVRSYTITGLQPGTDYKIYLYTLND
NARSSPVVIDASTAIDAPSNLHFLATTPNSLLISWQPPRARITGYIIKYEKPGSPPREVV
PRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGP
EILDVPSTVQKTPFITHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATP
IRHRPRPYPPNVGEEIQIGHVPRGDVDFHLYPYGLGLNPNASTGQEALSQTTISWTPFQE
SSEYIISCHPMGNDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVV
TVGNSVNEGLGQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSS
RWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQW
QKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPGTEGSTGHSYNQYSQRYHQRTNTNVNCP
IECFMPLDVQADREDSRE
Download sequence
Identical sequences F7ISE9
ENSCJAP00000022368 XP_002749796.1.60252 ENSCJAP00000022457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]