SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022856 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000022856
Domain Number - Region: 60-139,225-266,356-461
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00177
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022856   Gene: ENSCJAG00000012446   Transcript: ENSCJAT00000024182
Sequence length 474
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:9688175:9720706:1 gene:ENSCJAG00000012446 transcript:ENSCJAT00000024182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLHQFRMAEGTVTYRSKFLQSDTYKANSAQNRIVISEFGTLALPDPCKSVFERFLSRF
EPPGLVSAMTDNTNVNYVQYKGDYYLSTETNFMNKVDIETLEKTEKVDWSKFIAVNGATA
HPHYDPDGTAYNMGNSFGPYGFSYKVIRVPAEKVDTGETIHGARVICSIASAERGTPSYY
HSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTQFHVVDKHTGQLLP
GRYYSIPFVTFHQINAFEDQGCVVIDMCCQDNGRTLDVYQLQNLRKTGEGLDQVYNSAVR
SFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGKIWCSHENLYQEDLDKEGGIEL
PQINYAQFNGKKYRFFYGCGFRHLLGDSLIKVDVVNKTLKVWREDGFYPSEPIFVPVPGT
SEEDGGVVLSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFVPT
Download sequence
Identical sequences F7HMP2
ENSCJAP00000022856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]