SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022887 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022887
Domain Number 1 Region: 215-342,374-536
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.76e-45
Family WD40-repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 502-548,575-650
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000251
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 3 Region: 93-199
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000033
Family WD40-repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022887   Gene: ENSCJAG00000012469   Transcript: ENSCJAT00000024215
Sequence length 651
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:37676712:37709110:-1 gene:ENSCJAG00000012469 transcript:ENSCJAT00000024215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSCRLKLDWW
FSLNYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPD
MVTIATGQVAGTNRTKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLC
AVDESNDHMLSVWDWAKETKVVDVKNLSHPTKCSNEAVLVATFHPMDPTVLITCGKSHIY
FWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVL
GAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVSRDSGHGDTLYVGTTRN
SILQGSIHTGFSLLVQGHVEELWGLAAHPSRAQFVTCGQDKLVHLWSSETHQPLWSRIIE
DPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVG
SHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATC
KQITSADAVRNVEWATATCVLGFGVFGIWCEGADGTDINAVARSHDGKLLASADDFGKVH
LFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVA
Download sequence
Identical sequences F7IPP3
ENSCJAP00000022887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]