SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022908 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022908
Domain Number 1 Region: 206-357,429-506,546-713
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.39e-45
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 678-822
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000915
Family WD40-repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022908   Gene: ENSCJAG00000012469   Transcript: ENSCJAT00000024236
Sequence length 823
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:37676712:37712170:-1 gene:ENSCJAG00000012469 transcript:ENSCJAT00000024236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQALPRLPDDNLSGTSGMEVDDRVSALEQRLQLQEDELAVLKAALADALRRLRACEEQGA
ALRARGTPKGRAPPRLGLPTRTPLNGSGPPRRVGGYATSPSSPKKEATSGRRDVIRMPGG
PEEPTHPERAWDRDSTARDRGSALPLTRPRCSSETSRERKTKEVIFSVEDGSVKMFLRGR
PVPMLIPDELAPTYSLDTRSELPSCRLKLDWWFSLNYGYRGRDCRANLYLLPTGEIVYFV
ASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTIQDKVPLPPHVRIWDS
VSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKNL
SHPTKCSNEAVLVATFHPMDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLC
VTFLEGGDVVTGDSGGNLYVWGKASADPAPGHPAGGNRITQAVLGAHDGGVFGLCALRDG
TLVSGGGRDRRVVLWGSDYSKLQEVEVNSRYVKTTRTSSLYGDTLYVGTTRNSILQGSIH
TGFSLLVQGHVEELWGLAAHPSRAQFVTCGQDKLVHLWSSETHQPLWSRIIEDPARSAGF
HPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYV
YTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADA
VRNVEWATATCVLGFGVFGIWCEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQ
PRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVA
Download sequence
Identical sequences F7IHP4
ENSCJAP00000022908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]