SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023070 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023070
Domain Number 1 Region: 236-354
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 75-142,169-199
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000968
Family YccV-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023070   Gene: ENSCJAG00000012566   Transcript: ENSCJAT00000024406
Sequence length 367
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:95784710:95795299:1 gene:ENSCJAG00000012566 transcript:ENSCJAT00000024406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACAARRALAVGSRWSRSLTGARWPRPLCAEDGTGAFSPAASTTTRRHLSSRNRPEGKV
LETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGH
GSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDI
LPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTENI
RVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGV
VGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKT
PPSGLHW
Download sequence
Identical sequences F7IBC7
ENSCJAP00000023070 ENSCJAP00000023070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]