SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023086 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023086
Domain Number 1 Region: 332-415
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023086   Gene: ENSCJAG00000012620   Transcript: ENSCJAT00000024425
Sequence length 419
Comment pep:novel chromosome:C_jacchus3.2.1:16:66987187:66991816:-1 gene:ENSCJAG00000012620 transcript:ENSCJAT00000024425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLNVSFSNRNYDLDYDSVQPYFYCDEEDIWKKFELLPTPPLSPSRRSGLCSTSCVSVTP
FSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFS
AAAKLVSEKLASYQAARKDSSSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPL
NDSSSPKPCASPDSSAFSTSSDSLLSSTESSPRASPEPLVLHEETPPTTSSDSEEEQEDE
EIDVVSVEKRQPPGKRSESGSPSSGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYP
AAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQ
IPELENNEKAPKVVILKKATTYILSVQAEEQKLISEKDLLRKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences F7IB97
ENSCJAP00000023086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]