SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023734 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023734
Domain Number 1 Region: 412-610
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.83e-69
Family Hemopexin-like domain 0.00000000232
Further Details:      
 
Domain Number 2 Region: 38-168,341-396
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.02e-37
Family Matrix metalloproteases, catalytic domain 0.000000431
Further Details:      
 
Domain Number 3 Region: 227-284
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-21
Family Fibronectin type II module 0.0000585
Further Details:      
 
Domain Number 4 Region: 287-343
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000694
Further Details:      
 
Domain Number 5 Region: 171-226
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-20
Family Fibronectin type II module 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023734   Gene: ENSCJAG00000012929   Transcript: ENSCJAT00000025107
Sequence length 610
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:9454543:9479945:1 gene:ENSCJAG00000012929 transcript:ENSCJAT00000025107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY
NFFPNKPKWDKNQITYRILGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIM
INFGRWEHGDGYPFDGKDGLLAHAFSPSPGIGGDSHFDDDELWTLGEGQVVRVKYGNADG
EYCKFPFLFSGKEYNSCTDIGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQP
CKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV
FPFTFLGNKYESCTSAGRSDGKMWCATTASYDDDRKWGFCPDQGYSLFLVAAHEFGHAMG
LEHSKDPGALMAPIYTYTKNFRLSQDDIKGIQELYGVSPDIDLGTGPTPTLGPVTPEICT
QDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPDLPEKIDAVYEAPQEE
KTVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWR
YNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKF
GSIKSDWLGC
Download sequence
Identical sequences F7G084
ENSCJAP00000023734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]