SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023897 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023897
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily L domain-like 1.19e-36
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 308-425
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.24e-17
Family Hormone receptor domain 0.0053
Further Details:      
 
Domain Number 3 Region: 238-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000297
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000023897
Domain Number - Region: 760-847,920-936
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0173
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023897   Gene: ENSCJAG00000012977   Transcript: ENSCJAT00000025280
Sequence length 1318
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:168661471:168796876:1 gene:ENSCJAG00000012977 transcript:ENSCJAT00000025280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPERLRGRAQPPLLLPLALLALLALLGGGGGAAALPAGCKHDGRPRGAGRAAGAAEGK
VVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDP
GAFWGLSSLKRLDLTNNRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLGSLRSL
EFQTEYLLCDCNILWMHRWVKERNVTVRDTRCVYPKSLQAQPVTGVKQELLTCGPPLELP
SFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIHNC
SLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGDFR
WPRTLAGITAYLQCTRNSHGSGIYPGSPQDERKAWRRCDRGGFWADDDYSRCQYANDVTR
VLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKEL
GDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRVATYRLASGAHVYSTYSPNIAL
EAYVIKPTGFSGMTCTVFQKVAASDRTGFSDYGRRDPDGNLDKQLSFKCNVSNTFSSLAL
KNTIVEASIQLPPSLFSPKQKRELRPTDDSLYKLQLLAFRNGKLFPATGNSTNLADDGKR
RTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAVAARWDFDLLNGQGGWKSDGCHI
LYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPMVYTTAIILLLCLLAVIVSYI
YHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLW
IGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIRNYGS
RPNAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRL
AANENGEINHQDSMSLSLISTSVLENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYP
LDLVFSFVFGATCLSFSAFFMVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPDSSGT
NGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQCHANSLPLNTPQLDNSQT
EHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVPTSVEGSVQ
NGLPKSRLGSNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTSSKK
DMLRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDGTGNVRTGLWKHETTV
Download sequence
Identical sequences F7GX18
XP_002745992.1.60252 ENSCJAP00000023824 ENSCJAP00000023897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]