SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024418 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024418
Domain Number 1 Region: 307-374
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024418   Gene: ENSCJAG00000013260   Transcript: ENSCJAT00000025827
Sequence length 526
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:46028908:46269428:1 gene:ENSCJAG00000013260 transcript:ENSCJAT00000025827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS
PMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY
IRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR
IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSK
LEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHAC
Download sequence
Identical sequences A0A2K5ZRN7 F7FA74 G7NZ88 H9FUK9
XP_005547646.1.63531 XP_008980254.1.60252 XP_011826429.1.47321 XP_011915216.1.92194 XP_014985878.1.72884 ENSCJAP00000024418 ENSCJAP00000024418 ENSMMUP00000002800 ENSMMUP00000002800 9544.ENSMMUP00000002800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]