SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024578 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024578
Domain Number 1 Region: 102-257,359-426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-38
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Domain Number 2 Region: 792-967
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.92e-30
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024578   Gene: ENSCJAG00000013323   Transcript: ENSCJAT00000025995
Sequence length 969
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:1167888:1239893:1 gene:ENSCJAG00000013323 transcript:ENSCJAT00000025995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEGARAADEVRVPLGAPPPGPAAAAAAGASPASSGAPGREAERGSEPGASPPESPAAER
GAELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLG
MFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFI
VMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCF
FVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNG
MQKCSHIPSRRELRVPCTLGWEAYAQPQAEGVGAAANACINWNQYYNVCRSGASNPHNGA
INFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVI
ATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHVFRKLKRRSLRL
YARWQSRWRKKVDPGSVQGQGPGRRQRRAGRPTASVHHLVYHHHHHHHHHYHFSHGSPRR
PGPEPGVCDTRLVRAGAPHSPPSTGRRPPDAESVHSIYHADCHIEGPQERAQVAHAAATA
AASLKLATGLAAMNYPTILPSGPGSGKSSTSPGPKGKWASGPPGTGGHSPLRLDSPDPYE
KIQHVVGEHGLGQAPGHLSGLNVPCPLPSPPAGTLTCELKSCPYCTRALEDPEGELSGSE
SGDSDGHGIYEFTQDMRHGDRRDPMQQPPATGTPGPGSPRQRAQQRAAPGEPGRLGLLWA
TFSSKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEM
LLKLLACGPLGYIRSPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPA
LRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLQTDSGDTVPDRKNFDSL
LWAIVTVFQ
Download sequence
Identical sequences F7G0K2
ENSCJAP00000024578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]