SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024593 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024593
Domain Number 1 Region: 19-102
Classification Level Classification E-value
Superfamily Ribosomal protein L31e 1.44e-33
Family Ribosomal protein L31e 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024593   Gene: ENSCJAG00000013396   Transcript: ENSCJAT00000026011
Sequence length 126
Comment pep:novel chromosome:C_jacchus3.2.1:12:33228758:33229157:1 gene:ENSCJAG00000013396 transcript:ENSCJAT00000026011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTKKGGEKKNGRSAINDMVTREYTINIHKRIHGVGFKKCAPQALKEIRKFAMKETGTP
DVRIDTRLNKAVWAKGIRRNAPYQIRVRLSKKRNEDEDSPNKLCILVTYVPVTTFKNLQT
MWMRTN
Download sequence
Identical sequences F7F9G7
ENSCJAP00000024593 ENSCJAP00000024593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]