SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024594 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024594
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily POZ domain 9.81e-23
Family BTB/POZ domain 0.0078
Further Details:      
 
Domain Number 2 Region: 360-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000092
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 249-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000598
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 444-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000364
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024594   Gene: ENSCJAG00000013393   Transcript: ENSCJAT00000026012
Sequence length 514
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:152196384:152226025:-1 gene:ENSCJAG00000013393 transcript:ENSCJAT00000026012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLANHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSEC
VRLKPTDIQPDIFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFS
HPDQVFPLASSLYGIQIADHQLRQATKITSAPEKLGRDPRPQTSRISQEQVPEASQLSQL
TSNLAQVNRTNMTPSDPLQTSLSPELVSTPVPPPPPGEETNLEASSSDEQPATLTIAHVK
PSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRVPLTLCSNAA
DLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKR
RKYECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTM
VDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDE
GRSILLGSGDSEVTEPDHPVLASIKKEQETVLLD
Download sequence
Identical sequences F7F9G3
ENSCJAP00000024594 ENSCJAP00000024594 XP_002747158.1.60252 XP_017826962.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]