SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024617 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024617
Domain Number 1 Region: 1177-1339,1367-1446
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.41e-39
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 678-905
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-38
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1500-1751
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-35
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 1-155,257-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-31
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024617   Gene: ENSCJAG00000013323   Transcript: ENSCJAT00000026036
Sequence length 2238
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:1207598:1242209:1 gene:ENSCJAG00000013323 transcript:ENSCJAT00000026036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGL
FGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPTLLGLC
TAPPSLPHMQGESLSLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQ
TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVPCTLGWEAYAQPQAEGVGAAANACINW
NQYYNVCRSGASNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFI
LLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEEL
LKYVGHVFRKLKRRSLRLYARWQSRWRKKVDPGSVQGQGPGRRQRRAGRPTASVHHLVFS
HGSPRRPGPEPGVCDTRLVRAGAPHSPPSTGRRPPDAESVHSIYHADCHIEGPQERAQVA
HAAATAAASLKLATGLAAMNYPTILPSGPGSGKSSTSPGPKGKWASGPPGTGGHSPLRLD
SPDPYEKIQHVVGEHGLGQAPGHLSGLNVPCPLPSPPAGTLTCELKSCPYCTRALEDPEG
ELSGSESGDSDGHGIYEFTQDMRHGDRRDPMQQPPATGTPGPGSPRQRAQQRAAPGEPGR
LGLLWATFSSKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTS
MFALEMLLKLLACGPLGYIRSPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKL
VRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLQTDSGDTVPDR
KNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAIL
VEGFQAEGDANRSDSDEDKTSVHFEEDFHKFRDLQATELKMCSLAVTPNGHLEGRGSLPP
PLIMCTAATPMPTPKSLPYLDAPSLPASRRGSSSSGGPTLGDQKPLASLRGSPCAPWGPN
GAWSSRRSSWSSLGRAPSLKRRSQCGERESLLSGEGKGSTDDEAEDGRGTPGPRTSPLRR
AESLDPRPLRPAALPPTKCRDCNGQMVALPSEFFLRIDGHREEAAELDDDLEDSCCFRLR
KVLEPYKPQWCRSREAWALVFSPQNRFRDSCRKIITHKLFDHVVLIFIFLNCVTIALERP
DIDPGSTERVFLSISNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSL
VDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLI
CCAFFIIFGILGVQLFKGKFYYCEGADTRNISTKAECRAAHYRWVRRKYNFDNLGQALMS
LFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVE
NFHKCRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSIHSLCTS
HYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRF
FKDRWNQLDLAIVLLSLMGITLEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMR
ALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGM
AFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVV
AVLMKHLEESNKEAREDAELDAEIELEMAQGPGDARGVDSDGPPSPQESRGAGDAPNLLV
ARKVSVSRMLSLPNDSYMFRPVAPAPSPRPRPLQEVEMETYGGGTRPGSATSVHSPPAES
CASLQVPLAISSPCSSESIHTVSLRCTACSPSFSWLLCRQEAIRTDSLEGQIDSPRDTLD
AVEPPEKTLVRLASQGGSLQSPQRSPRPASVRTRKHTFGQRCVSSRPAAPGGEEAEAADP
ADEEVSHITSSACPWQPATEPHGPEASPAPCGSERDLRRFYSVDAQGFLDKPGRADEQWR
PLAEPGSGEPGEGKAWGSDAEPALGARRKKKMSPPCISVEPPAEDEGSSRPPATEGSSTI
LRRRTPSCEAAPHRDSLEPTEGSGAGGDPAGKGERWGQASCRAEHLTVPSFAFEPLDLGG
PSGDPFLDSGHDVTPEPRASSSGAIAPLEPPEAEPAMPDSDPPEKRHGLYLTVPQCPLEK
PGSPSVTPAPGGDADDPV
Download sequence
Identical sequences F6QA32
ENSCJAP00000024617 ENSCJAP00000024578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]