SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024688 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024688
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily E set domains 1.47e-21
Family Arrestin/Vps26-like 0.022
Further Details:      
 
Domain Number 2 Region: 147-309
Classification Level Classification E-value
Superfamily E set domains 4.62e-17
Family Arrestin/Vps26-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024688   Gene: ENSCJAG00000013439   Transcript: ENSCJAT00000026109
Sequence length 431
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:181710744:181720082:1 gene:ENSCJAG00000013439 transcript:ENSCJAT00000026109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVACTGSCGVSSKANDAAW
VVEESYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
QALRLHADIENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPLSPGPGPGLP
PRVPALVVPSAPPQEEAEAAVGGPHFLDPVSLSTKSHSQQQPPLGTLGSVPGTPEPGPRN
GSPAPHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQSC
GGVDPSLNPES
Download sequence
Identical sequences F6TBG6
ENSCJAP00000024688 XP_002743553.1.60252 ENSCJAP00000024688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]