SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024714 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024714
Domain Number 1 Region: 164-354
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.04e-40
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 24-129
Classification Level Classification E-value
Superfamily POZ domain 3.93e-32
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024714   Gene: ENSCJAG00000013456   Transcript: ENSCJAT00000026137
Sequence length 354
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:147965896:147968551:-1 gene:ENSCJAG00000013456 transcript:ENSCJAT00000026137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGGRGQKNLEEPGGGGETMHASQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFF
NEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEE
YKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAV
SVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFI
RSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLK
SCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWYTIVTMTTLG
Download sequence
Identical sequences F6S2R3
ENSCJAP00000024714 ENSCJAP00000024714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]