SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025309 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025309
Domain Number 1 Region: 22-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.32e-113
Family Transferrin 0.000000223
Further Details:      
 
Domain Number 2 Region: 364-711
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.47e-112
Family Transferrin 0.000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025309   Gene: ENSCJAG00000013749   Transcript: ENSCJAT00000026745
Sequence length 738
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:17939889:17966705:1 gene:ENSCJAG00000013749 transcript:ENSCJAT00000026745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRSAALWLLVALRTVLGGMEVRWCTISDPEQQKCSDMSKAFREAGIQPSLFCVQGTSA
NHCIQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVKRSSHVT
INTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSNYFGGSCVPGAGDTG
YSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFKLLCRDGSWADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSDAYGQKNLMFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFSRQQLRPEIQCVSAESPQHCMEQIQAGHIDAVTL
SSEDIYMAGKTYGLVPAAGERYASEDKSNSYFVVAVVKRDSSHAFTLDELRGKRSCHASF
GSPAGWDIPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNAKNYPSSLCALCVGDEQ
GRNKCAGNSQERYYGYSGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWADELRSEDYE
LLCPNGARAEVSQFVACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDYNKNGFKM
FDSSNYHGQDLLFKDATVRAVPVGEKTTYRDWLGLDYVAALEGMLSQQCSGAAASASGAP
LLPLLLPVLAARLLAPAL
Download sequence
Identical sequences F7C025
ENSCJAP00000025309 ENSCJAP00000025309 XP_002758266.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]