SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025357 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025357
Domain Number 1 Region: 31-201,235-401
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.19e-75
Family YicI catalytic domain-like 0.00098
Further Details:      
 
Domain Number 2 Region: 404-484
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.01e-16
Family Putative glucosidase YicI, domain 3 0.013
Further Details:      
 
Domain Number 3 Region: 616-662
Classification Level Classification E-value
Superfamily Trefoil 0.0000000209
Family Trefoil 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000025357
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00217
Family YicI N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025357   Gene: ENSCJAG00000036807   Transcript: ENSCJAT00000026796
Sequence length 696
Comment pep:novel chromosome:C_jacchus3.2.1:8:103952318:104008989:-1 gene:ENSCJAG00000036807 transcript:ENSCJAT00000026796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTLQPAPAITYRTIGGVLDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRD
YGGINKLKEVVSRNRLAEIPYDVQYSDIDYMDGKKDFTVDQDAYSGLSDFVKELHDNGQK
YLIIMNPGIAKDSSYEPYNNGSIKRVWIMGNHGSAVGEGYPGPTVFPDYSNPVCTEWWIY
QVINFHNRLEFDGVWIEMNEVSSLHQASDQCESNTLNFPPFTPRVLDRLLFARTLCMDTE
FQGGLHYDFHSLYGYFMARATDLALKNIFTDKRSFILSRSTFAGSGKFAAHWLGDNAATW
DDLRWSISSILEFNVFGIPMVGANICGYNNNVTEELCRRWMQLGAFYPLSRNHNGPGFRD
QDPAAFGADSLLLNSSRHYLNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDSATWE
LHEQFLWGPGLLITPVLYEGVDEVKAYIPDATWYDYETGVAIPWRKQFVNMLLPGDKIGL
HLRGGYIFPTQKPNTTTEASRRNSLGLIIALDYKREANGELYWDDGVSKDAVTGKQYILY
DFSVASNHLQAKILFNNYTDTYNLMFTDITILGMDKQPANFTVLLNNIATSSPSVVYSAS
TKVVTITDLQGLVLGQEFSIKWNLPVDDLEKFNCYPDDPTASEESCRQRGCLWEHTSTPG
VPTSAAVAASDSLSAKISFLRLSVIYHTANMLQVKV
Download sequence
Identical sequences F7AGK0
ENSCJAP00000025357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]