SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025559 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025559
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.32e-77
Family Phosphate binding protein-like 0.00000348
Further Details:      
 
Domain Number 2 Region: 239-297,331-352
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 2.62e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025559   Gene: ENSCJAG00000013900   Transcript: ENSCJAT00000027014
Sequence length 361
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:16726387:16735000:1 gene:ENSCJAG00000013900 transcript:ENSCJAT00000027014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNATATVEENSPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPH
DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQ
QEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDMVGVLHD
PETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQDTMQATIH
VPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDIARQLNDA
H
Download sequence
Identical sequences F6XT45
ENSCJAP00000025559 ENSCJAP00000025559 XP_002754553.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]