SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025701 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025701
Domain Number 1 Region: 18-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-59
Family Calnexin/calreticulin 0.00016
Further Details:      
 
Domain Number 2 Region: 176-301
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.02e-17
Family P-domain of calnexin/calreticulin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025701   Gene: ENSCJAG00000013978   Transcript: ENSCJAT00000027160
Sequence length 383
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:15481345:15503780:-1 gene:ENSCJAG00000013978 transcript:ENSCJAT00000027160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAPVPLWAICLLRVALATVYFQEEFLDGEHWRNRWVQSTNDSRFGHFRVSSGNFYGHK
EKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADVDQK
NLNEKSQYYIMFGPDICGFDIKKVHVILHFKNQYHENKKLIRCKVDGFTHLYTLILRPDL
SYDVKIDGQSIESGSIEYDWNLTSLKKEKSLAELKDPELTEDNKAQDWEKHFLDASASRQ
SDWNGGLDGDWQAAMLRKPPCQDGLKPEGIDRDIWLHHKMKNTNYLTQYDLSEFENIGAI
GLELWQVICLSQVVRRLLEGRDPLSTDMHLATWKHNPWPLEMDAIQAKEEMKKAREEEEE
ELRSGEINGHENYFNRFHKRNEL
Download sequence
Identical sequences F6XRC1
ENSCJAP00000025701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]