SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025796 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025796
Domain Number 1 Region: 384-478
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.12e-36
Family Small-conductance potassium channel 0.00000531
Further Details:      
 
Domain Number 2 Region: 253-426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-26
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000025796
Domain Number - Region: 485-543
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00549
Family Outer membrane efflux proteins (OEP) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025796   Gene: ENSCJAG00000014026   Transcript: ENSCJAT00000027256
Sequence length 560
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:16996587:17051054:1 gene:ENSCJAG00000014026 transcript:ENSCJAT00000027256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRACSEPKPCTQVVMNSHSYNGGVGRPLGSGPGALGREPPDPEAGCPPQPPHSPGLQ
VVVAKSEPAVPSPGSRRGQPQDQDDEEDDEEDEAGGRRGSGKPSNVGHRLGHRRALFEKR
KRLSDYALIFGMFGVVVMVTETELSWSVYTKESLYSFALKCLISLSTAILLGLVVLYHAR
EIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAE
ADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPG
TVLLVFSISSWIIAAWTVRVCERYHDNQEVTINFLGAMWLISITFLSIGYGDMVPHTYCG
KGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETW
LIYKHTRLVKKPDQSRVRKHQRKFLQAIHQSRRLRSVKIEQGKLNDQANTLTDLAKTQSV
MYDLVSELHAQHEELEARLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPP
DQAARSSPCRWPPVATSDCG
Download sequence
Identical sequences F7CSC6
ENSCJAP00000025789 ENSCJAP00000025796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]