SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025797 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025797
Domain Number 1 Region: 383-477
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.07e-36
Family Small-conductance potassium channel 0.00000531
Further Details:      
 
Domain Number 2 Region: 252-425
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-26
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025797   Gene: ENSCJAG00000014026   Transcript: ENSCJAT00000027259
Sequence length 540
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:17021062:17050639:1 gene:ENSCJAG00000014026 transcript:ENSCJAT00000027259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPQAACSEPKPCTQVVMNSHSYNGGVGRPLGSGPGALGREPPDPEAGCPPQPPHSPGLQV
VVAKSEPAVPSPGSRRGQPQDQDDEEDDEEDEAGGRRGSGKPSNVGHRLGHRRALFEKRK
RLSDYALIFGMFGVVVMVTETELSWSVYTKESLYSFALKCLISLSTAILLGLVVLYHARE
IQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEA
DVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGT
VLLVFSISSWIIAAWTVRVCERYHDNQEVTINFLGAMWLISITFLSIGYGDMVPHTYCGK
GVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWL
IYKHTRLVKKPDQSRVRKHQRKFLQAIHQSRRLRSVKIEQGKLNDQANTLTDLAKTQSVM
YDLVSELHAQHEELEARLATLESRLDALGASLQALPGLIAQAIRPPPPRLPGQRAGLDHG
Download sequence
Identical sequences F7CSB5
ENSCJAP00000025797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]