SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026004 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026004
Domain Number 1 Region: 214-278
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.47e-16
Family B-box zinc-binding domain 0.0000335
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000026004
Domain Number - Region: 88-129,170-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0374
Family Transferrin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026004   Gene: ENSCJAG00000014137   Transcript: ENSCJAT00000027484
Sequence length 591
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:17800848:17834765:-1 gene:ENSCJAG00000014137 transcript:ENSCJAT00000027484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAADASRSNGSSPEARDARSPSGPNGSLENGTRADGKDAKTTNGHSGEAAEGKSLGSAL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSLEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSEPRKPSVSIVEPGEARRNSYPRADTGLFSPAKSSSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPMHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEVEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIVDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYMNNYTNSFGGEWSAPDTMKRYSMYLTPKAG
TGKTPYQFTSLGQATAEFSKPLGRSGLSKNNPGTCPFPIPPLFSPTAGQSIIQTAQGSPK
SLVFPGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
Download sequence
Identical sequences F7I2I2
ENSCJAP00000026004 ENSCJAP00000026004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]