SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026172 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026172
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.42e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0019
Further Details:      
 
Domain Number 2 Region: 251-360
Classification Level Classification E-value
Superfamily PH domain-like 2.65e-20
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 135-231
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026172   Gene: ENSCJAG00000014210   Transcript: ENSCJAT00000027656
Sequence length 381
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:92368754:92406989:-1 gene:ENSCJAG00000014210 transcript:ENSCJAT00000027656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRERNKKRLLELLQAAGTGNSHCADCGAADPDWASYKLGVFICLNCCGVHRNFPDISK
VKSVRLDFWDDSIVEFMTRNGNLHVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERR
EFMADGETISLPGNREGFLWKRGRNNSQFLRRRFVLLAREGLLKYYTKEEGKSPKAVISI
KDLNATFQTEKIGHPHGLQITYRRDSHVRNLFVYHESGKEIVDWFNALRAARLQYLKMAF
PELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDSHERRLLYYKNPLDAFEQG
QVFLGNNEQGYEVYGDLPKGIRGNRWKAGLTIVTPERRFVLTCPNEKEQQEWLESLWGVL
SSPLTPLSHLTASTESGCHSR
Download sequence
Identical sequences F7I4U9
XP_002748383.1.60252 ENSCJAP00000026172 ENSCJAP00000026172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]