SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026317 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026317
Domain Number 1 Region: 47-189
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.88e-35
Family cAMP-binding domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000011
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026317   Gene: ENSCJAG00000014312   Transcript: ENSCJAT00000027812
Sequence length 224
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:69569740:69577421:1 gene:ENSCJAG00000014312 transcript:ENSCJAT00000027812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPVMYNLIILVCRACFPDLQHGYLGAWLVLDYTSDLLYLLDIVVRFHTDHALVKKYMK
LQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHMSTLSRVQIFQN
CEASLLEELVLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGITQYAVLGAGL
YFGEISIINIKGGYPSICSRDKDRERDEQQSAVLRSDSTSGLNF
Download sequence
Identical sequences F7IGH6
ENSCJAP00000026317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]