SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026400 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026400
Domain Number 1 Region: 359-704
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.86e-138
Family Transferrin 0.0000000000584
Further Details:      
 
Domain Number 2 Region: 23-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.29e-125
Family Transferrin 0.0000000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026400   Gene: ENSCJAG00000002848   Transcript: ENSCJAT00000027903
Sequence length 705
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:42700401:42732921:-1 gene:ENSCJAG00000002848 transcript:ENSCJAT00000027903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAVGALLACAVLELCLAVPEKTVRWCAVSEHEATKCHSFRDHMKSVLPPDGPRVACVK
KASYLDCIKGIAANEADAVTLDAGLVYEAALAPNNLKPVVAEFYGSKEDPQTFYYAVAVV
KKDSGFQLNELRGKKSCHTGLGRSTGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVPC
ADGTAFPQLCQLCPGCGCSTLQQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD
EYELLCLDNTRKPVDEYKDCHLARVPSHTVVARSVGGKEDLIWELLNQAQEHFGKDKSKE
FQLFGSPLGKDLLFKDSAYGFFKVPPRMDAKMYLGYEYVTAIRNLREGVCPEAPAGECKA
VKWCAVSHHERLKCDEWSVNSVGKIECESAETTEDCIAKIMNGEADAMSLDGGFVYIAGK
CGLVPVLAENYNSSKTHTLPLPSCSDDILEGYFAVAVVKKSTADLTWDTLKGKKSCHTAV
GRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSAKNSSFCKLCMGTGPNKCEPNSKEGY
YGYTGAFRCLVEKGDVAFVKHQTVTQITGDDNPEAWAKNLNKDDFELLCLDGSRKSVDKF
ESCHLARAPNHAVVTRKDKADCVQQVLLDQQKIFGRSVPDCSSYFCMFRSETKDLLFRDD
TVCLAKLHDKNTYEKYLGEEYVKAVGNLRKCSTSPLLEACTFHRT
Download sequence
Identical sequences F7HZZ3
ENSCJAP00000026400 ENSCJAP00000005295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]