SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026529 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026529
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.67e-50
Family Ran-binding protein mog1p 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026529   Gene: ENSCJAG00000014422   Transcript: ENSCJAT00000028043
Sequence length 146
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:73570559:73571335:-1 gene:ENSCJAG00000014422 transcript:ENSCJAT00000028043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGKQQVAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPP
Download sequence
Identical sequences F7IIP8
ENSCJAP00000026529 XP_002747976.1.60252 ENSCJAP00000026529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]