SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026538 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026538
Domain Number 1 Region: 53-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026538   Gene: ENSCJAG00000014432   Transcript: ENSCJAT00000028052
Sequence length 207
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:188644779:188656530:1 gene:ENSCJAG00000014432 transcript:ENSCJAT00000028052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNSLLILLEAAEYLERRERGSGGAPFPHCSGPFWDQKASCSCLCLSVSLNRSSHNELE
KHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKVGGEPSGRCVGPGGFHQDC
ALCGSAPLPRASVSRKERDGPAPSTWPDPIPALFSSEVDIEGMEFGPGELDSVGSSDADD
HYSLQSGSSSDSGFGPHCRRLGRPALL
Download sequence
Identical sequences F7IGC8
ENSCJAP00000026538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]