SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026567 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026567
Domain Number 1 Region: 139-241
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 6.02e-34
Family Elongation factor TFIIS domain 2 0.0046
Further Details:      
 
Domain Number 2 Region: 258-308
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.29e-17
Family Transcriptional factor domain 0.00021
Further Details:      
 
Domain Number 3 Region: 1-47
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000000144
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026567   Gene: ENSCJAG00000014407   Transcript: ENSCJAT00000028081
Sequence length 310
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:6877355:6931761:-1 gene:ENSCJAG00000014407 transcript:ENSCJAT00000028081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLVSPGKYRGRDHISQIWKE
RRLECKDWGLAMLPGLNGPSTEKDLDEKKKEPAITSQNSPEAREESHIYIASHNFTSSIN
SPIILCSPIYTPFFVFSSNVLAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQ
IEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASD
ELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVC
NECGNRWKIC
Download sequence
Identical sequences F7IBK7
ENSCJAP00000049213 ENSCJAP00000026567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]