SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026600 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026600
Domain Number 1 Region: 70-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.96e-48
Family Ribosomal protein S7 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026600   Gene: ENSCJAG00000014458   Transcript: ENSCJAT00000028116
Sequence length 242
Comment pep:novel chromosome:C_jacchus3.2.1:5:124492002:124496462:1 gene:ENSCJAG00000014458 transcript:ENSCJAT00000028116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPPAVKVSRGWSGLRRSCGGILQHQGERLTQVRWSRYSAEFKDPLIDKEHYRKPVEKLTE
EEKYDRELKKTQLIKAAPAAKTSSVFEDPVVSKFTNMMMKGGNKILARSLMTQTLESVKR
KQFEKYHAASAEEQATIERNPYIIFHQALRNCEPMIGLVPILRGGRIYQVPTSLPDRRRR
FLAMKWMITECRENKHRRMLMPEKLSHELLEAFHNQGPVIKRKHDMHKMAEANRALAHYR
WW
Download sequence
Identical sequences F7I282
ENSCJAP00000026600 ENSCJAP00000026600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]