SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026840 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026840
Domain Number 1 Region: 360-461
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026840   Gene: ENSCJAG00000014556   Transcript: ENSCJAT00000028370
Sequence length 1291
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:73692612:73703661:1 gene:ENSCJAG00000014556 transcript:ENSCJAT00000028370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPLEGADGGGDPSPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAAI
LLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCR
IRGGPDRDLGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPVL
PLDTDIQELSEQIHRLLLQPVHSPSSTGFSGVGPMTSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRAWPQPRTRLPATGTFKAKTLPCQSPDPELETG
PAPIQAPLALAPEEAERKEASSSSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTTS
SASDDDKQRTGPVPVGTKKDPPSAVLSGEGATPRKEPVVGGTLSPLTLANKAESVVSATS
QCSFSSTIVHVGDKKLPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTK
AVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALVSETGCHHSPAPQSRRHHCRSKA
KRSRHHQNPRAETPCYVSHPSPVPPSTPWPPPPATTPFPAVVQPYPLQVFSPRGGPQPLP
PAPTSVPQAAFPTPLVTPMVALVLPNYLFPTSSSYPYGAPQTPAEGPATASHSPSPSLPA
LPPSPPRGPDSPLFNSRCSSPLQLNLLQLEESPRAEGAAVAGGPGSSAGPPPPNEKAAEP
EARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGCS
TSASITRSSQSSHTSKYFGSIDSSEAEAGAARAEAEPGDQVIKYVLQDPIWLLMANADQR
VMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVM
ACVDCGSSTQDPGHPDDPLFELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAGAQVGAK
ASSSQDLAMEEEEEGRSSASPALPTAGNSAS
Download sequence
Identical sequences F7I4E6
ENSCJAP00000026840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]